Sequence: AWLTEIHEYAQHDVALMLLGNKVDSAHERVVKREDGEKLAKEYGLPFMETSAKTGLNVDLAFTAIAKELKRRSMKAPSEPRFRLHDYVKREGRGASCC
Ras-related oncogene protein; Ras-related protein Rab-26; V46133
Cat # 16165146
100 µg
Cat # 16643155
100 µL
Cat # 13405807
100 µL
Cat # 16155146
50 µg
Cat # 15634415
100 µL
Cat # 16892854
20 µL
Cat # 17249183
100 µL
Cat # 16135146
50 uL
Cat # 16882854
150 µL
Cat # 15586422
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.