Sequence: MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP
DKFZp781H0695/HSPC137/MGC8900; RAB family small GTP binding protein RAB 23; Ras-related protein Rab-23
Cat # 16157246
100 µL
Cat # 16857953
150 µL
Cat # 16867953
20 µL
Cat # 17157148
400 µL
Cat # 11356853
100 µg
Cat # 15996724
100 µL
Cat # 16190283
50 µg
Cat # 15753981
100 µL
Cat # 16089526
100 ug
Cat # 15504301
100 µL
Cat # 16539721
100 µL
Cat # 15946734
100 µL
Cat # 15763981
100 µL
Cat # 17208603
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.