Sequence: MALRELRVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRRHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC
GTP-binding protein RAB22A; MGC16770; Rab-22; Ras-related protein Rab-22A
Cat # 16152653
100 µL
Cat # 16142653
50 µg
Cat # 15742062
100 µL
Cat # 16162653
100 µg
Cat # 16895714
20 µL
Cat # 16819653
20 µL
Cat # 15536632
100 µL
Cat # 16885714
150 µL
Cat # 16600525
100 µL
Cat # 16809653
150 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.