Sequence: TDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC
Ras-related protein Rab-1B; small GTP-binding protein
Cat # 16140447
50 uL
Cat # 17241496
150 µL
Cat # 16887814
150 µL
Cat # 16897814
20 µL
Cat # 16395304
100 µL
Cat # 17251496
20 µL
Cat # 16680515
100 µL
Cat # 15993745
100 µL
Cat # 17147298
200 µL
Cat # 16150447
100 µg
Cat # 15876713
100 µL
Cat # 16579541
100 µL
Cat # 16306504
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.