Sequence: IMKWVSDVDEVGDATSLPGCGEGASPGKARRGPDGKANASRKLCLPQPWMKTSGTHQKASRRSLLGIRLMRSRNGRWEESKGSSWRRSMAWTSMKQVPAPTSTLKSHSRV
-; RAB15, member RAS onocogene family; Ras-related protein Rab-15; Ras-related protein Rab-15 isoform AN1; Ras-related protein Rab-15 isoform AN2; Ras-related protein Rab-15 isoform AN3
Cat # 16182907
100 µg
Cat # 15603095
400 µL
Cat # 15856713
100 µL
Cat # 15777321
100 µL
Cat # 16660515
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.