Sequence: SGLEKLKTVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHLTHDELISLLLQRERELSQRDEHVQELESYIDRLLVRIMETSPTLLQIPPGPP
DKFZp434H018/GAF1/KIAA0857/RIP11/pp75; Gaf-1; Gamma-SNAP-associated factor 1; Phosphoprotein pp75; RAB11 family interacting protein 5 (class I); Rab11 family-interacting protein 5; Rab11-FIP5; Rab11-interacting protein Rip11
Cat # 16165286
100 µg
Cat # 16189138
50 µg
Cat # 16863304
20 µL
Cat # 17278593
100 µL
Cat # 13499026
100 µL
Cat # 16853304
150 µL
Cat # 15795531
100 µL
Cat # 15843174
100 µL
Cat # 15785531
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.