Sequence: MQDPNADTEWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHEDEFNEEDERAIEMYRRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD
HTPHLP; HTPHLP/MGC3062/PHLP3/VIAF/VIAF1; IAP-associated factor VIAF1; phosducin-like 3; Phosducin-like protein 3; PhPL3; VIAF-1; Viral IAP-associated factor 1
Cat # 16194023
200 uL
Cat # 17121244
100 µL
Cat # 15584971
100 µg
Cat # 15791741
100 µL
Cat # 16184023
50 µg
Cat # 16104033
100 µg
Cat # 15926804
100 µL
Cat # 16803964
20 µL
Cat # 15763421
100 µL
Cat # 16893954
150 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist Now
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.