Sequence: MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK
28 kDa heat- and acid-stable phosphoprotein; HASPP28/PAP/PAP1; PAP; PAP1; PDGF-associated protein; PDGFA-associated protein 1
Cat # 16106562
100 µg
Cat # 15576712
100 µL
Cat # 16844084
20 µL
Cat # 16019257
400 uL
Cat # 15751672
100 µL
Cat # 16834084
150 µL
Cat # 16187180
100 uL
Cat # 15779961
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.