Sequence: MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT
PC-TP; Phosphatidylcholine transfer protein; StAR-related lipid transfer (START) domain containing 2; StAR-related lipid transfer protein 2; STARD2; START domain-containing protein 2
Cat # 16113073
200 uL
Cat # 16193063
50 uL
Cat # 16103073
100 µg
Cat # 16169306
200 uL
Cat # 16159306
50 uL
Cat # 15792581
100 µL
Cat # 15683075
400 µL
Cat # 16808063
20 µL
Cat # 16102829
50 µg
Cat # 16898053
150 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.