Sequence: IFGESGDEEEEEFTGFNQEDLEEEKGETQVKEAEDSDSDDNIKRGKHMDFLSDFEMMLQRKKSMSGKRRRNRDGGTFISDADDVVSAMIVKMNEAA
DKFZp761G0123/FLJ10006/FLJ14655/FLJ32319/MGC126375/MGC126376; interacts with Spt6; IWS1 homolog; IWS1-like protein; Protein IWS1 homolog
Cat # 16195520
100 uL
Cat # 16826734
150 µL
Cat # 15711762
100 µL
Cat # 16667064
100 µL
Cat # 16541462
100 µL
Cat # 15745271
100 µL
Cat # 15896043
100 µL
Cat # 15953715
100 µL
Cat # 16836734
20 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.