Sequence: DGSCSTDFKTTRSREQVLRVFEEFVQGDEEVLRRYLNRLQQIRDTLEVSEFFRRHEV
Inositol 1,4,5-trisphosphate 3-kinase A; Inositol-trisphosphate 3-kinase A; insP 3-kinase A; IP3 3-kinase A; IP3K A; IP3KA
Cat # 16166000
100 uL
Cat # 15931755
100 µL
Cat # 16882834
150 µL
Cat # 16352715
100 µL
Cat # 16337354
100 µl
Cat # 16028907
400 uL
Cat # 16018907
400 uL
Cat # 16627574
100 µL
Cat # 16892834
20 µL
Cat # 15707051
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.