Sequence: LKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSENGVSLCLP
AIF4/AIP4/NAPP1/dJ468O1.1; AIP4; atrophin-1 interacting protein 4; Atrophin-1-interacting protein 4; E3 ubiquitin-protein ligase Itchy homolog; HECT-type E3 ubiquitin transferase Itchy homolog; Itch; itchy E3 ubiquitin protein ligase homolog; NAPP1; NFE2-associated polypeptide 1
Cat # 16168270
100 µL
Cat # 17227243
100 µL
Cat # 11316643
100 µg
Cat # 17238953
100 µL
Cat # 16840505
150 µL
Cat # 16090308
100 ug
Cat # 15928284
100 µL
Cat # 17267043
100 µL
Cat # 16313444
100 µL
Cat # 15991445
100 µg
Cat # 16850505
20 µL
Cat # 16324535
100 µg
Cat # 15762261
100 µL
Cat # 16264220
100 uL
Cat # 16501512
100 µL
Cat # 17229133
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.