Sequence: MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVD
FLJ12671; interferon stimulated exonuclease gene 20kDa like 2; interferon stimulated exonuclease gene 20kDa-like 2; Interferon-stimulated 20 kDa exonuclease-like 2
Cat # 16154720
100 uL
Cat # 15713671
100 µL
Cat # 16863125
20 µL
Cat # 15899233
100 µL
Cat # 16853125
150 µL
Cat # 15886113
100 µL
Cat # 16630745
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.