Sequence: RELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK
2310020H20Rik/HML/ISU2/MGC74517/NIFU/NIFUN/hnifU; Iron-sulfur cluster assembly enzyme ISCU, mitochondrial; IscU iron-sulfur cluster scaffold homolog; NifU-like N-terminal domain-containing protein; NifU-like protein
Cat # 16107362
100 µg
Cat # 16197352
100 µg
Cat # 15807716
100 µL
Cat # 15818593
100 µL
Cat # 15731232
100 µL
Cat # 13444967
100 µL
Cat # 16883644
20 µL
Cat # 16873644
150 µL
Cat # 16696524
100 µL
Cat # 15736341
100 µL
Cat # 16124746
50 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.