Sequence: MAAAWGSSLTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQICLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKL
HBLD1/ISA2/c14_5557; HESB-like domain-containing protein 1; Iron-sulfur cluster assembly 2 homolog, mitochondrial
Cat # 16195849
50 µg
Cat # 16821304
20 µL
Cat # 17140924
100 µg
Cat # 16811304
150 µL
Cat # 17186953
100 µL
Cat # 15724401
100 µL
Cat # 13228368
400 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.