Sequence: PMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP
Interferon regulatory factor 1; interferon regulatory factor 1 isoform +I9; interferon regulatory factor 1 isoform d78; interferon regulatory factor 1 isoform delta4; interferon regulatory factor 1 isoform delta7; IRF-1; IRF-1/MAR
Cat # 16160225
100 µg
Cat # 16393695
100 µL
Cat # 15722754
25 ug
Cat # 15614445
100 µL
Cat # 13460726
100 ug
Cat # 16159407
100 µL
Cat # 17248213
100 µL
Cat # 13428934
100 ug
Cat # 16808343
20 µL
Cat # 15935085
100 µg
Cat # 16150225
100 µg
Cat # 16345424
100 µL
Cat # 15716187
100 ul
Cat # 16898333
150 µL
Cat # 16149407
50 µg
Cat # 17239603
100 µL
Cat # 15762694
25 ug
Cat # 13418874
100 ug
Cat # 15731862
100 µL
Cat # 15974454
100 µL
Cat # 16140225
50 uL
Cat # 15777144
25 ug
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.