Sequence: GDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGT
Interleukin-1 receptor-associated kinase 4; IPD1/NY-REN-64/REN64; IRAK-4; Renal carcinoma antigen NY-REN-64
Cat # 16035495
100 µg
Cat # 16149682
100 µg
Cat # 16035736
100 ug
Cat # 16005495
100 µg
Cat # 16129682
50 uL
Cat # 13463937
100 µL
Cat # 16828284
150 µL
Cat # 13473937
100 µL
Cat # 16095485
100 µg
Cat # 10396186
100µg
Cat # 16012627
100 ug
Cat # 11513901
100 µg
Cat # 16126636
100 ug
Cat # 11558041
100 µg
Cat # 16139682
50 µg
Cat # 16071248
100 ug
Cat # 16015495
100 µg
Cat # 11522430
100 µL
Cat # 16838284
20 µL
Cat # 16010476
100 uL
Cat # 12304063
100 µL
Cat # 15745397
0.1 mg
Cat # 12818042
100 µg
Cat # 15792294
25 ug
Cat # 13448444
100 ug
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.