Sequence: KPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDF
interleukin-1 receptor associated kinase-2; interleukin-1 receptor-associated kinase 2; Interleukin-1 receptor-associated kinase-like 2; IRAK-2; IRAK-2/MGC150550
Cat # 16130225
100 µg
Cat # 13421887
100 µL
Cat # 12868132
100 µg
Cat # 16110225
100 µg
Cat # 16150215
50 uL
Cat # 12858372
100 µg
Cat # 11516271
100 µL
Cat # 15768184
25 ug
Cat # 12848152
100 µg
Cat # 16048677
400 uL
Cat # 16190215
200 uL
Cat # 16058677
400 uL
Cat # 16364085
100 µL
Cat # 12878322
100 µg
Cat # 15976204
100 µL
Cat # 16040497
100 ug
Cat # 16170215
200 uL
Cat # 17185413
100 µL
Cat # 16030497
100 ug
Cat # 16180215
50 µg
Cat # 16120225
100 µg
Cat # 13481476
100 ug
Cat # 17126213
100 µL
Cat # 16579041
100 µL
Cat # 16050417
100 ug
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.