Sequence: SSLLFVYEGSSQPTTTKLNDRTLAEKFLSKGQLSDTEVLEYNNNFHVLSSTANGKIESSVGKSLSKMYARHRKIYTKKHHSQTSLKVENLEQDNGWKSMSQEHLNGNVLS
Inositol 1,3,4,6-tetrakisphosphate 5-kinase; Inositol polyphosphate multikinase
Cat # 16112577
50 uL
Cat # 17149373
100 µL
Cat # 16697684
100 µL
Cat # 15716021
100 µL
Cat # 15526912
100 µL
Cat # 16187199
50 µg
Cat # 16197199
100 µg
Cat # 13297498
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.