Sequence: GLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQLVYHVENEGAAGVDRWANKGGLIAYRSRKRLETFLSLLVQNLAPAETHT
Inositol polyphosphate 1-phosphatase; IPP; IPPase; MGC110984
Cat # 16140185
100 µg
Cat # 16150185
200 uL
Cat # 16130185
100 µg
Cat # 16120185
100 µL
Cat # 15745671
100 µL
Cat # 15993025
100 µL
Cat # 15598792
100 µg
Cat # 16136921
100 µg
Cat # 13267518
100 µL
Cat # 16596221
100 µL
Cat # 16110185
50 µg
Cat # 15735671
100 µL
Cat # 16100185
50 uL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.