Sequence: MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF
Eaf4/FLJ20089/ING2/p47ING3; inhibitor of growth family, member 3; Inhibitor of growth protein 3; p47ING3
Cat # 16127616
200 uL
Cat # 15524342
100 µL
Cat # 16629444
100 µL
Cat # 13421877
100 µL
Cat # 16029046
100 ug
Cat # 16827603
20 µL
Cat # 15514342
100 µL
Cat # 16107616
100 µg
Cat # 16117616
100 µg
Cat # 15949614
100 µL
Cat # 16187606
50 uL
Cat # 16817603
150 µL
Cat # 17197783
100 µL
Cat # 17109543
100 µL
Cat # 16865724
150 µL
Cat # 15923355
100 µL
Cat # 16875724
20 µL
Cat # 16180643
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.