Sequence: IGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEAACNRLANKAVQRGSADNVTVMVVRIGH
DKFZp434J2031/FLJ10181/MGC4846/PP2C-DELTA; ILKAP; integrin-linked kinase associated phosphatase; Integrin-linked kinase-associated serine/threonine phosphatase 2C; protein phosphatase 2c, delta isozyme; protein phosphatase, Mg2+/Mn2+ dependent 1O
Cat # 16175063
100 µg
Cat # 16120367
50 µg
Cat # 16835464
20 µL
Cat # 15683805
100 µL
Cat # 16825464
150 µL
Cat # 16672965
100 µL
Cat # 13455247
100 µL
Cat # 16307834
100 µL
Cat # 16303335
100 µL
Cat # 15760051
100 µL
Cat # 16168090
100 uL
Cat # 16510702
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.