Sequence: SEAKHQPPSDFLWKEQDKFRASPDCITILCKPNGQAIAWYTPIHWKQAWEKLDADVEFNRCSVVSPTFRKRVFQWTASTATITKE
FLJ36004/Pas1c1; intermediate filament tail domain containing 1; Intermediate filament tail domain-containing protein 1; Lamin tail domain-containing protein 1
Cat # 16014827
100 uL
Cat # 16095887
100 ug
Cat # 15546292
100 µL
Cat # 15917984
100 µL
Cat # 15625235
100 µL
Cat # 15921355
100 µg
Cat # 15738941
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.