Sequence: PTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALRTYEPYGSLVQQIRILLLGP
Interferon-induced protein 44; interferon-induced, hepatitis C-associated microtubular aggregate protein (44kD); Microtubule-associated protein 44; MTAP44/p44; p44; TBC/LysM-associated domain containing 5
Cat # 16178800
100 µL
Cat # 16609874
100 µL
Cat # 15952875
100 µL
Cat # 16520682
100 µg
Cat # 16855505
150 µL
Cat # 15525722
100 µL
Cat # 16192796
100 µg
Cat # 16182796
50 µg
Cat # 15938124
100 µL
Cat # 16549801
100 µL
Cat # 15793441
100 µL
Cat # 16865505
20 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.