Sequence: IPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYR
IPP isomerase 1; IPP1/IPPI1; isopentenyl diphosphate dimethylallyl diphosphate isomerase 1; Isopentenyl pyrophosphate isomerase 1; Isopentenyl-diphosphate Delta-isomerase 1
Cat # 16119804
100 µg
Cat # 16607054
100 µL
Cat # 16129157
50 µg
Cat # 15716561
100 µL
Cat # 16109804
50 uL
Cat # 15586392
100 µL
Cat # 16199794
50 uL
Cat # 16878053
150 µL
Cat # 16888053
20 µL
Cat # 13249918
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.