Sequence: HYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGR
ICD-M; ICD-M/IDH/IDHM/IDP/IDPM/mNADP-IDH; IDH; IDP; isocitrate dehydrogenase 2 (NADP+), mitochondrial; Isocitrate dehydrogenase [NADP], mitochondrial; NADP(+)-specific ICDH; Oxalosuccinate decarboxylase
Cat # 16119794
100 µg
Cat # 11317393
100 µg
Cat # 16865334
150 µL
Cat # 16023817
100 ug
Cat # 16053547
100 ug
Cat # 15955005
100 µg
Cat # 16875334
20 µL
Cat # 16109794
100 µL
Cat # 16569441
100 µL
Cat # 17288163
100 µL
Cat # 12869122
100 µg
Cat # 16391704
100 µg
Cat # 17279873
100 µL
Cat # 15924004
100 µg
Cat # 16822265
20 µL
Cat # 16129794
100 µg
Cat # 16389274
100 µL
Cat # 15358250
100 µL
Cat # 16812265
150 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.