Sequence: SQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSWLEFTLENIFWPELK
HSTE14/MGC39955/MST098/MSTP098/PCCMT/PCMT/PPMT; Isoprenylcysteine carboxylmethyltransferase; pcCMT; PPMT; Prenylated protein carboxyl methyltransferase; Prenylcysteine carboxyl methyltransferase; protein-S isoprenylcysteine O-methyltransferase; Protein-S-isoprenylcysteine O-methyltransferase
Cat # 16104726
50 uL
Cat # 15575802
100 µL
Cat # 16302515
100 µL
Cat # 16065357
400 uL
Cat # 16816255
150 µL
Cat # 15724811
100 µL
Cat # 15745976
0.1 ml
Cat # 16526181
100 µL
Cat # 16626754
100 µL
Cat # 15714811
100 µL
Cat # 16826255
20 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.