Sequence: KDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAI
FLI/FLIL/Fli1/MGC39265; flightless I actin binding protein; flightless I homolog; Protein flightless-1 homolog
Cat # 16103450
100 uL
Cat # 17258003
100 µL
Cat # 16339244
100 µL
Cat # 16123540
100 uL
Cat # 16329334
100 µL
Cat # 13444477
100 µL
Cat # 13247818
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.