Sequence: DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST
EMP-2; Epithelial membrane protein 2; MGC9056/XMP; Protein XMP
Cat # 16143780
100 uL
Cat # 15705036
0.1 ml
Cat # 15652895
400 µL
Cat # 15595182
100 µL
Cat # 15771161
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.