Sequence: GIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWK
dJ63G5.3 (putative Leucine rich protein); extracellular leucine-rich repeat and fibronectin type III domain containing 2; Extracellular leucine-rich repeat and fibronectin type III domain-containing protein 2; KIAA1904/LRRC62/dJ63G5.3; Leucine-rich repeat and fibronectin type-III domain-containing protein 6; Leucine-rich repeat-containing protein 62; Protein phosphatase 1 regulatory subunit 29
Cat # 16103140
100 uL
Cat # 15566082
100 µL
Cat # 15759410
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.