Sequence: MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
eIF-5A-2; EIF-5A2/eIF5AII; eukaryotic initiation factor 5A; Eukaryotic initiation factor 5A isoform 2; Eukaryotic translation initiation factor 5A-2
Cat # 16192159
50 µg
Cat # 16138776
100 µg
Cat # 16307694
100 µL
Cat # 16323995
100 µL
Cat # 16383914
100 µL
Cat # 16390015
100 µL
Cat # 16128776
50 uL
Cat # 13279578
100 µL
Cat # 16886894
150 µL
Cat # 16102169
100 µL
Cat # 15945644
100 µL
Cat # 15933765
100 µL
Cat # 13435277
100 µL
Cat # 16896894
20 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist Now
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.