Sequence: LGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKG
Cleavage and polyadenylation-specific factor 3-like protein; CPSF3-like protein; CPSF73L/FLJ13294/FLJ20542/INT11/INTS11/RC-68/RC68; Int11; Integrator complex subunit 11; Protein related to CPSF subunits of 68 kDa; RC-68; related to CPSF subunits 68 kDa
Cat # 16174900
100 uL
Cat # 16581312
100 µL
Cat # 15723751
100 µL
Cat # 17279553
100 µL
Cat # 15773951
100 µL
Cat # 15537072
100 µL
Cat # 16174980
100 uL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.