Sequence: ANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA
carbamoyl-phosphate synthase (ammonia); carbamoyl-phosphate synthase 1, mitochondrial; Carbamoyl-phosphate synthase [ammonia], mitochondrial; Carbamoyl-phosphate synthetase I; carbamoylphosphate synthetase I; CPSase I
Cat # 16126614
100 ug
Cat # 15942865
100 µL
Cat # 16082556
100 ug
Cat # 16061596
100 ug
Cat # 16157380
100 uL
Cat # 16167380
100 uL
Cat # 16888574
150 µL
Cat # 17177513
100 µL
Cat # 17136123
100 µL
Cat # 16672835
100 µL
Cat # 17165373
100 µL
Cat # 16399714
100 µL
Cat # 15827793
100 µL
Cat # 16570442
100 µg
Cat # 16072556
100 ug
Cat # 16882985
20 µL
Cat # 16898574
20 µL
Cat # 16872985
150 µL
Cat # 16116614
100 ug
Cat # 16214400
40 ug
Cat # 17196693
100 µL
Cat # 16051596
100 ug
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.