Sequence: SDLGLNNITAKALAYGDTNCCRDGRSSKHPEENHADRRVPIGVDHVRRSVMVEAEGVPRAYTYSAFFCPSERVHISTPNKYEFQYVQR
alpha-2 macroglobulin family protein VIP; C3 and PZP-like, alpha-2-macroglobulin domain containing 8; FLJ42058/FLJ90618/K-CAP/KIAA1283/VIP
Cat # 16195230
100 uL
Cat # 15764611
100 µL
Cat # 15774611
100 µL
Cat # 17122204
100 µg
Cat # 15754611
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.