Sequence: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
COX VIb-1; COX6B/COXG; Cytochrome c oxidase subunit 6B1; Cytochrome c oxidase subunit VIb isoform 1; cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous)
Cat # 16103431
100 ug
Cat # 15863014
100 µL
Cat # 16158070
100 uL
Cat # 16878493
150 µL
Cat # 16156554
200 uL
Cat # 16888493
20 µL
Cat # 16126554
50 uL
Cat # 15770021
100 µL
Cat # 13240099
100 µL
Cat # 17107513
100 µL
Cat # 16136554
50 µg
Cat # 16146554
50 ug
Cat # 17197503
100 µL
Cat # 16639854
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.