Sequence: MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK
COX IV-2; COX4/COX4-2/COX4B/COX4L2/COXIV-2/dJ857M17.2; Cytochrome c oxidase subunit 4 isoform 2, mitochondrial; Cytochrome c oxidase subunit IV isoform 2; cytochrome c oxidase subunit IV isoform 2 (lung); cytochrome c oxidase subunit IV-like 2
Cat # 16170847
100 ug
Cat # 16818563
150 µL
Cat # 15603855
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.