Sequence: MHGHGGYDSDFSDDERCGESSKRKKRTVEDDLLLQKPFQKEKHGKVAHKQVAAELLDREEARNRRFHLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGE
F26C11.1-like/FRA10A/FRA10AC1; fragile site 10q23.3; Protein FRA10AC1; rare folic acid-type fragile site, FRA(10)(q23.3), candidate gene 1
Cat # 16197443
100 µg
Cat # 15559192
100 µg
Cat # 15746571
100 µL
Cat # 13415487
100 µL
Cat # 16175799
100 µL
Cat # 16165799
50 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.