Sequence: EYEKKQTLGQNDTGFSCDGTANTFRVMFKEPIEILPNVCYTACATLKGPDSHYGTKGLKKVVHETPAASKTVFFFFSSPGNNNGTSIEDGQIPEIIFYT
BTB (POZ) domain containing 1; BTB/POZ domain-containing protein 1; C15orf1/NS5ATP8; HCV NS5A-transactivated protein 8; Hepatitis C virus NS5A-transactivated protein 8
Cat # 16197356
50 uL
Cat # 16117366
50 µg
Cat # 16835244
20 µL
Cat # 15594472
100 µL
Cat # 16825244
150 µL
Cat # 16107366
50 µL
Cat # 15702102
100 µL
Cat # 17197383
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.