Sequence: WAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDF
BEX family member 4; BEX1-like protein 1; BEXL1/FLJ10097; brain expressed X-linked-like 1; brain expressed, X-linked 4; Brain-expressed X-linked protein 4; Nerve growth factor receptor-associated protein 3; Protein BEX4
Cat # 16084757
100 uL
Cat # 15778741
100 µL
Cat # 15958424
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.