Sequence: LLDDHKDVVTLLAEGLRESRKHIEDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPLDY
-; [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial; BCKD-kinase; BCKDHKIN; branched chain alpha-ketoacid dehydrogenase kinase; Branched-chain alpha-ketoacid dehydrogenase kinase
Cat # 16128850
100 µL
Cat # 16560332
100 µL
Cat # 16142316
50 µg
Cat # 15761631
100 µL
Cat # 16016727
400 uL
Cat # 16039167
400 uL
Cat # 13462157
100 µL
Cat # 16132316
50 uL
Cat # 15974594
100 µL
Cat # 16353255
100 µL
Cat # 16670925
100 µL
Cat # 15623695
100 µL
Cat # 13475977
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.