Sequence: EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
activating transcription factor B; B-ATF; B-ATF/BATF1/SFA-2/SFA2; B-cell-activating transcription factor; basic leucine zipper transcription factor, ATF-like; Basic leucine zipper transcriptional factor ATF-like; SF-HT-activated gene 2 protein; SFA-2
Cat # 16192736
100 µg
Cat # 15789033
100 ug
Cat # 16065777
100 ug
Cat # 15599446
100 Tests
Cat # 15788964
25 ug
Cat # 15769033
100 ug
Cat # 15540157
100 Tests
Cat # 15759033
100 ug
Cat # 17199403
100 µL
Cat # 16851754
150 µL
Cat # 15504272
100 µL
Cat # 15749033
100 ug
Cat # 15721962
100 µL
Cat # 16861754
20 µL
Cat # 15527256
100 Tests
Cat # 17177373
100 µL
Cat # 15799033
100 ug
Cat # 16660995
100 µL
Cat # 15345391
100 µg
Cat # 15778964
100 ug
Cat # 16172736
50 µg
Cat # 15739033
100 ug
Cat # 16162736
50 uL
Cat # 15243417
100 Tests
Cat # 15779033
100 ug
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.