Sequence: RNPQQQESLKHATRIIDEVVNKFLDDLGNAKSHLMSLYSACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSKTLQQNAESRFN
BAG family molecular chaperone regulator 2; BAG-2; BAG-2/KIAA0576/MGC149462/dJ417I1.2; BAG-family molecular chaperone regulator-2; Bcl-2-associated athanogene 2; BCL2-associated athanogene 2; dJ417I1.2 (BAG-family molecular chaperone regulator 2)
Cat # 16190876
100 µg
Cat # 13455427
100 µL
Cat # 15911555
50 µL
Cat # 15942785
100 µL
Cat # 15754537
0.05 ml
Cat # 15934435
100 µg
Cat # 17179335
100 µL
Cat # 16539631
100 µL
Cat # 16379664
100 µL
Cat # 11365933
100 µg
Cat # 16180876
50 uL
Cat # 16033677
100 uL
Cat # 16354395
100 µg
Cat # 16058726
50 uL
Cat # 16019357
100 ug
Cat # 15788555
100 µL
Cat # 16166018
100 µL
Cat # 13461857
100 µL
Cat # 16156018
50 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.