Sequence: VGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNRE
B4Gal-T4/beta4Gal-T4; Beta-1,4-galactosyltransferase 4; Beta-1,4-GalTase 4; Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase; beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 4; Lactotriaosylceramide beta-1,4-galactosyltransferase; N-acetyllactosamine synthase; Nal synthase; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 4; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4
Cat # 16149065
100 µg
Cat # 13435067
100 µL
Cat # 15729161
100 µL
Cat # 16175188
100 µL
Cat # 16660105
100 µL
Cat # 16517641
100 µL
Cat # 15909294
100 µL
Cat # 16804284
150 µL
Cat # 16139065
50 uL
Cat # 16165188
50 µg
Cat # 15833074
100 µL
Cat # 16814284
20 µL
Cat # 15916514
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.