B4GALT2 Antibodies
Sequence: MPSTQLLAAAAAAATAPGPTPPPLAPGSLRSPVPCPVPRLPRCHPVLTRHLVLRVHRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKVSRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITVDIGRPPSWPPRG
Synonyms
B4Gal-T2/B4Gal-T3/beta4Gal-T2; Beta-1,4-galactosyltransferase 2; Beta-1,4-GalTase 2; beta-4-GalT2; Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase; beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 2; Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase; Lactose synthase A protein; N-acetyllactosamine synthase; Nal synthase; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 2; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2; UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 2; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2
Cat # 16192782
50 µg
Cat # 16819854
20 µL
Cat # 17137373
100 µL
Cat # 16809854
150 µL
Cat # 16650105
100 µL
Cat # 15749391
100 µL
Cat # 15992395
100 µL
Cat # 15997694
100 µL
Cat # 16182782
50 µL
Custom Antibody Service
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist Now
Performance Guarantee
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
We’re here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.