Sequence: NLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILM
B3GN-T1/B3GN-T2/B3GNT/B3GNT-2/B3GNT1/BETA3GNT; Beta-1,3-galactosyltransferase 7; Beta-1,3-GalTase 7; beta-1,3-Gn-T1; beta-1,3-Gn-T2; Beta-1,3-N-acetylglucosaminyltransferase 1; beta-1,3-N-acetylglucosaminyltransferase bGnT-1; beta-1,3-N-acetylglucosaminyltransferase bGnT-2; Beta-3-Gx-T7; BGnT-1; BGnT-2; N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2; UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 7; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 7; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2
Cat # 16103026
100 µg
Cat # 15955694
100 µL
Cat # 16367504
100 µL
Cat # 11316783
100 µg
Cat # 15985694
100 µL
Cat # 16118440
100 µL
Cat # 16193016
50 uL
Cat # 16020598
100 ug
Cat # 15720191
100 µL
Cat # 16580322
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.