Sequence: AEKIFKVSLGIRRLHLEDVYVGICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRKLH
Beta-1,3-galactosyltransferase 2; Beta-1,3-GalTase 2; beta-3-galt2; BETA3GALT2/GLCT2/beta3Gal-T2; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase 2; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2; UDP-galactose:2-acetamido-2-deoxy-D-glucose 3beta-galactosyltransferase 2
Cat # 16189075
100 µg
Cat # 15813074
100 µL
Cat # 15897783
100 µL
Cat # 16842704
150 µL
Cat # 16852704
20 µL
Cat # 16610105
100 µL
Cat # 16179075
100 µg
Cat # 15585961
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.