Sequence: MSSSNVEVFIPVSQGNTNGFPATVSNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVEKEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLING
ABC transporter; ABC15/ABCP/BCRP/BCRP1/BMDP/CD338/CDw338/EST157481/MGC102821/MRX/MXR/MXR1; ATP-binding cassette sub-family G member 2; ATP-binding cassette transporter G2; ATP-binding cassette, sub-family G (WHITE), member 2 (Junior blood group); Breast cancer resistance protein; Broad substrate specificity ATP-binding cassette transporter ABCG2; CD338; CDw338; Mitoxantrone resistance-associated protein; multi drug resistance efflux transport ATP-binding cassette sub-family G (WHITE) member 2; placenta specific MDR protein; Placenta-specific ATP-binding cassette transporter; Urate exporter
Cat # 16120616
50 µL
Cat # 16030256
100 uL
Cat # 16130616
50 µg
Cat # 16046786
1 mL
Cat # 16020256
100 uL
Cat # 16075387
100 uL
Cat # 16140616
100 µg
Cat # 16075986
1 mL
Cat # 16036786
1 mL
Cat # 16055155
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.