Sequence: SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK
AI414027/AI449286/SUR2A/SUR2B/Sur2; ATP-binding cassette sub-family C member 9; ATP-binding cassette transporter sub-family C member 9; Sulfonylurea receptor 2; sulfonylurea-binding protein 2
Cat # 16210490
100 µg
Cat # 16240480
100 µg
Cat # 15585432
100 µL
Cat # 16220490
100 µg
Cat # 16210480
100 µg
Cat # 16610095
100 µL
Cat # 16220480
100 µg
Cat # 16290480
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.