Sequence: MNKMALASFMKGRTVIGTPDEETMDIELPKKYHEMVGVIFSDTFSYRLKFNWGYRIPVIKEHSEYTEHCWAMHGEIFCYL
ATP-binding cassette A10; ATP-binding cassette sub-family A member 10; ATP-binding cassette, sub-family A (ABC1), member 10; EST698739
Cat # 16152396
100 µg
Cat # 16610085
100 µL
Cat # 15751131
100 µL
Cat # 15588942
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.