Sequence: AEWLGLLGDEQVPQAESILDALSKHLVMKLSYGPEEKDMIVMRDSFGIRHPSGHLEHKTIDLVAYGDINGFSAMAKTVGLPTAMAAKMLLDGEIGAKGLMGPFSKEIYGPILERIKA
alpha-aminoadipate semialdehyde synthase; Alpha-aminoadipic semialdehyde synthase, mitochondrial; aminoadipic semialdehyde synthase; LKR; LKR/SDH; LKR/SDH/LKRSDH/LORSDH; Lysine ketoglutarate reductase; lysine-2-oxoglutarate reductase; lysine-ketoglutarate reductase /saccharopine dehydrogenase; Saccharopine dehydrogenase; SDH
Cat # 16124230
100 uL
Cat # 16184230
100 uL
Cat # 15792191
100 µL
Cat # 15506862
100 µL
Cat # 15772181
100 µL
Cat # 15772191
100 µL
Cat # 16104240
100 uL
Cat # 16182380
100 ug
Cat # 17237563
100 µL
Cat # 16591792
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.